SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00044582m|PACid:23801207 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00044582m|PACid:23801207
Domain Number 1 Region: 120-258
Classification Level Classification E-value
Superfamily Hypothetical protein TM0160 9.68e-37
Family Hypothetical protein TM0160 0.0022
Further Details:      
 
Weak hits

Sequence:  Pavirv00044582m|PACid:23801207
Domain Number - Region: 292-321
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0262
Family C-terminal UvrC-binding domain of UvrB 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00044582m|PACid:23801207
Sequence length 326
Sequence
MAMEGPVLCRPAMQAKLPSAALISNSLVKSGQLGTAFFGAMSKYRNITRFISPISQPPVK
NSSHVCCSFSSSSDGNGYMAGNFSESDEDYVNSTVLEAVEVRSGSEGYVIKMRDGKNLRC
VHNNSQGRNIPESAPQPAIVLRIEDGSETLLPIIVLEMPSVLLMAAIRNVHIARPTIYQV
VKEMIDKMGYEVKLVRVNKRIQEAYCAELYLTKTEDPTDSITFDLRPSDAINIAVRCKVP
IQVHRSLAYSDGIRAVEPARMAVAAGVSEGLLFTELDRPDGQPCLEAQEFGLVRNMLIAA
VEERYKDAASWKDKLMQLRSKRKNWA
Download sequence
Identical sequences Pavirv00044582m|PACid:23801207 Pavirv00044583m|PACid:23801208 Pavirv00044584m|PACid:23801209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]