SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00052472m|PACid:23774138 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00052472m|PACid:23774138
Domain Number 1 Region: 9-100
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000484
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00052472m|PACid:23774138
Sequence length 107
Sequence
MIVNRSRADWRASVTKIPIRIEDIEKVPSVSEEIRVMLRSNPNVSNSDVPYCYLSRLESS
YGELTIGCNLKNMRKDEWLSAEQDILLGAARIIKSHGIELGSTMQCC
Download sequence
Identical sequences Pavirv00052472m|PACid:23774138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]