SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00065487m|PACid:23765720 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00065487m|PACid:23765720
Domain Number 1 Region: 51-120
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000085
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0042
Further Details:      
 
Weak hits

Sequence:  Pavirv00065487m|PACid:23765720
Domain Number - Region: 141-225
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0994
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00065487m|PACid:23765720
Sequence length 435
Sequence
MGFDFITKALYTGIWIAAVSLFMELLGFNTQKWITAGGFGTVLLTLAGREIFTNFLSSVM
INATRPFVVNEWINAKIDGVEISGIVEHVGWWSPTIIRGDDREAIYIPNHKFTVSIVRNN
TQRTHWRIKTYLAISHMDAGKIGVIVADMRKVLAKNPHIEQQKLHRRVFFEKIDPKNQAL
MIYISCFVKTSHVEEYLNVQEAVMLDLLRIVGHHKARLATQIRTVQKSYGNADFDNIPFG
EDMYSRTRGRPLLIDTSARISDDKAKPRQALSREDQKGKTNGSVQIKSATLENRNVSNSE
KQEQKKLVTEDARMKNSKSDNVTPVIPSSDAVSSTSKTGKGKAQELEATERQGDGSVSLP
NPKKESSPAFEDNIVLGVALEGSKRTLPIEEGNPYPSHTKSETDTVEAASSPKEKIAQRP
KISGQERTDQRNVDR
Download sequence
Identical sequences Pavirv00065487m|PACid:23765720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]