SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00066097m|PACid:23770897 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00066097m|PACid:23770897
Domain Number 1 Region: 123-195
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-17
Family Linker histone H1/H5 0.016
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000294
Family DNA-binding domain of telomeric protein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00066097m|PACid:23770897
Sequence length 298
Sequence
MGAPKQRWTPEEEAALKAGVAKHGPGKWRTILRDPDFSTLLRLRSNVDLKDKWRNLSVTA
GGYGSREKARMALKKGRRVVPKLTAEPMDVDANGLDNVHDAVIDAEPLAMSVEPLALEGS
PEKSVARLDDLILEAIKKLKEPSGSNKAAIAAYIEEQYWLPADFQRLLSTKLKALVNSGK
LMKVNQKYRIAPSSPSLGGISTKVYSAEEMNGDNNAKQLTKPQVDAELEKMKGMAKEEAA
AFAAKAVAEAEVAIAEAEEAARIAELAENDAETAKAFLEAVTLSMRDRNAASMMLRAC
Download sequence
Identical sequences Pavirv00066097m|PACid:23770897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]