SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00000342m|PACid:23818358 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00000342m|PACid:23818358
Domain Number 1 Region: 569-650
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000112
Family Myb/SANT domain 0.0000373
Further Details:      
 
Domain Number 2 Region: 373-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000207
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00000342m|PACid:23818358
Sequence length 671
Sequence
MVMRKRSDYGSRGRRVATMPRVPNSARGKRTTRKKKDEMCAFDLLATVAGTLLADQDNSA
NAPNTSGAAKAKNEKAAKEEPHDEIPPLKNTVMEKDCCSGCVVGSGGICSFPRQANNCLA
ENSSTRNEAGSILESLTVKSNMLVRDSLVSCTRPCETSRGLGIIPEFGAHGICHPGSSGS
AEAEQVHQAESNVVRRQADGHAPALHSLFNSVDLDGRPPALVSSDSSSCVPLCSHDKEHQ
TSSLCRGEVQYTADKDDDENSSGCTDPSTIGDKGYKPQYLGNHRIRKLLASKVRKAARNK
ICGGIRSKKICGGMSNKGSKLNLCSKKIPATRQKGQRTIFKKKKLAHRATSFAKQMPTEA
SATSMEGRNKSCGSDDYHVKLRIKSFNIPELFINVPENATIGSLKRTVMDVVNSIMQGGL
RVGVLLQGKDIQDDNKTLRQAGICHDKKLNNIDFTLECESGQDSPSRVLIPEQVDLLSAD
VVEPLARMKCEEHFPETGGDDTQQRIPPYRSRSLSDLYSVVHPVEMASQDTSASSQAIVP
VAPSEDGALAIVPLCKPRPSDIGLRRTRRPFTVGEVEALVEAVELIGTGRWRAVKMHAFD
HVDHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLAAQAYWSQQQAKLQDKPH
GKAALPEICPA
Download sequence
Identical sequences Pavirv00000342m|PACid:23818358 Pavirv00000343m|PACid:23818357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]