SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00000686m|PACid:23797868 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00000686m|PACid:23797868
Domain Number 1 Region: 9-100
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000017
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00000686m|PACid:23797868
Sequence length 107
Sequence
MIVNRSRADWRASVTKIPIRIEDIEKVPSVSEEIRVMLRSNPNVSNSDVPYCYLSRLESS
YGELTIGCNLKNMRKDEWLSAEQDILLGAARIIKLHGIELGSTMQCC
Download sequence
Identical sequences Pavirv00000685m|PACid:23797869 Pavirv00000686m|PACid:23797868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]