SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00003614m|PACid:23800534 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00003614m|PACid:23800534
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily BAG domain 1.7e-21
Family BAG domain 0.004
Further Details:      
 
Domain Number 2 Region: 58-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.13e-16
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00003614m|PACid:23800534
Sequence length 288
Sequence
MMRARPRGTFADAMRESSPPAAAAPAAAAAAVKEDEWEVRPGGMLVQKRSPDADAPAGAL
VSTIRVKVKFNGVYHEIYINAQASFGELKKMLSAKTGLHPEDQKLVYKDKERDSKAFLDM
AGVRDRSKMVLLEDPAAQAKRLLEQRRTDKAERAAKSISRISLDVDKLATKVSALETIVG
KGGKVVDADVVTLTEALMNELVKLDSIAADGEVKVQRRMQEKRVQKYVETLDAIRAKNAA
GTPRANGNGAANAERARQGPRAAPPAAPAARVAAAELPAAARAGARAR
Download sequence
Identical sequences Pavirv00003614m|PACid:23800534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]