SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00003714m|PACid:23819297 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00003714m|PACid:23819297
Domain Number 1 Region: 194-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000103
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 53-181
Classification Level Classification E-value
Superfamily POZ domain 0.00000000487
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00003714m|PACid:23819297
Sequence length 574
Sequence
MEPMDSQVTAVALSDSDSFSVDGADAADADLQALRRLSDNLAAAFRCPDDFAFLADARIA
VPGAPDLRVHRCVLCARSPFLRDLFARRAAGAGEGKDKDKVELRELLGEEVEVGYEALQL
VLEYLYSGRVGALPKAACLCVDEGGCAHVGCRPAVAFMAQVLFAASTFEVGELTSLFQRR
LLDVLDKVEVDNLPLILCVANLCSKSCAKLLERCLEIVVRSNLDMITLEKALPPNVVEQI
VDARLSLGLVSPEDKGFPNIHVRRVHRALDSDDVELVRMLLKEGKTNLDDAYALHYAVEH
CDSKITTELLDLALADVNHRNPRGYTVLHIAAMRMEPKIIVSLLTKGARPSDLTFDNRKA
VQISKRLSKHGDYFGPTEDGKPSPKDRLCIEILEQAERRDPQLGEASVSLAIAGDCLRGK
LLYLENRVALARILFPMEAKVAMDIAQVDGTMEFNLGSSGNLPPGIQRTTVDLNDTPFIM
KEEHLTRMRALSKTVELGKRFFPRCSKVLDQIMDDEPELASLGRDTSTEKKRRFHDLQNV
VQKAFCEDKEENDRSARSSSSSSTTSMGAVRPRR
Download sequence
Identical sequences Pavirv00003714m|PACid:23819297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]