SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00006866m|PACid:23824966 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00006866m|PACid:23824966
Domain Number 1 Region: 466-583
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-25
Family UBX domain 0.0022
Further Details:      
 
Domain Number 2 Region: 2-44
Classification Level Classification E-value
Superfamily UBA-like 0.000000204
Family TAP-C domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00006866m|PACid:23824966
Sequence length 586
Sequence
MARPPQEAIDTFVSITGADEAAAVRVLEEHGNDLNGAVNAYFNEGDRSTTRVNQNPVPAS
DDDMELDEPLDPMFNRPLFPRALGNPFALLDPGLANITAADIFRRGPQVTHPREVRQIPI
EVKDTNTLTGSSGQGPVIEDLTGRESFYGPEVHGTVIVDDDDEDLPSTPSAHDPNIPSST
SRPNHSMPSAPPLVDVSDYNNDIEEQMIRAAIEASKREAEVMTNGLNSGESENTSRGRGD
DELARAVSLSLETAERERALRQEDVADHSPNLSDKEDTEGASEMIQRQGLIGKVGTSEQT
VDEENFQDDIGDDDEQPLVRHRYRRVRNRTTDPMESVQMANSPPSSSHPHNVQNDHQHNG
GFEEWGGISSEEHDEAVMLEAAMFGGIPEGAPYPFSFPTRGRSTQYPRVARPPSPTLTAQ
RLLREQQDDEYHAALQADREKELKAVQEAELRRAEEAAAREAALERQKKEEEEKLKKQRE
EEELESELAAKQASLPKEPLQNDEGAVTVVVRMPDGSRRGRRFLKSDKIQYLFDFIDISR
TFKPGTYRLVRSYPRRAFTDGESQMSLSDLGLTSKQEALFLEKISG
Download sequence
Identical sequences Pavirv00006866m|PACid:23824966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]