SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00007021m|PACid:23822908 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00007021m|PACid:23822908
Domain Number 1 Region: 77-164
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.44e-20
Family Ubiquitin-related 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00007021m|PACid:23822908
Sequence length 307
Sequence
MGTITCELESSYAATAGAGAGKARLDGKLGVPPREQRWFAFAGDSKGKGRRLGGGGRGGA
ADGSWYGGRFLRRRTGGGMQVFVRTLGGRSLALDVSPSDTVDAVKAWVQARERVAAADQR
LVFAGRELGDGRRTLAEYGVGKEANLFLHRRLRGGAGGGAGAAGSRRATTAAAGVLAAVV
AIGAALAYFSVPAAAAAAAAGASGMTLSLAVLLLAWALAMAGVNLITAGVFLAGRAETVR
CAVQSAVVGKASAFVRRNLAVVGVAAASSAATGVIFGGGDRTLCFVSFALFLVAMSLVTI
GVANCAR
Download sequence
Identical sequences Pavirv00007021m|PACid:23822908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]