SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00007142m|PACid:23807461 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00007142m|PACid:23807461
Domain Number 1 Region: 112-209
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000992
Family UBX domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00007142m|PACid:23807461
Sequence length 283
Sequence
MEAEYPHHQAGPSSSTTTLLWPCPTRRRKRGEDSDDDLSPASVSMDPDADAQRAADKLKA
VSEELGNQIRVFSREKFALQPNKLPGADHEEDDDFYELQPADYFNLVSNRIAEQSKMLKT
RKMREAELAAQRAKITKAVMRVRFPDGYVLEADFLPSERIHSLVDLLMKVLARPDLPFYL
YTVPPKKRILDTSQDFYTAGFVPGANIHFSYDLPEGSYTDNLKAGPFLREEIQSLDGLSL
LLKPASEPDDSRMNLSALQSSVSQPDPVPTTNKKPGKPKWLKR
Download sequence
Identical sequences Pavirv00007142m|PACid:23807461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]