SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00009344m|PACid:23761127 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00009344m|PACid:23761127
Domain Number 1 Region: 77-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-44
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 514-590
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000131
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00009344m|PACid:23761127
Sequence length 622
Sequence
MSSDELYRELWHVCAGPLVTVPRQGERVYYFPQGHMEQILCSVVNVELRAEADSDEVYAQ
IMLQPEADQSKLTSPDHELQEPDKCTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLD
MSQNPPCQELVAKDLHGTEWHFRHIFRGQPKRHLLTTGWSVFVSSKRLVAGDAFIFMRGE
NGELRVGVRRLMRQVNSMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPRTSRSDFI
VSVNKYLEAKKQKISVGMRFKMRFEGDEAPERRFSGTIIDIGSLPAMSKSLWADSDWRSL
KVQWDEPSSILRPERISPWEVEPLVAANPQSPQPPSRNKRARPPASPSMVAELPSGFGLW
KSPTDSARTLSFSEPQRARELFPSIPTSTFSSSSNINFNSKNEPSMLNSQFYWSARDTRA
DSCAASTNTVIVEKKQEHNSGGCRLFGIDICSAEEEVLPVVTAPALGYDQTAASVELSSD
KLSQPSDVNNSDAPGASSERLPLESQSRQVRSCTKVIMQGMAVGRAVDLTKLSGYSDLFH
KLEEMFDIQGELGSALKKWRVIYTDDEDDMMLVGDDPWNEFCDMVKRIYIYTYEEAKKLT
SKSKLPGSSDTSKLSDVSSQSE
Download sequence
Identical sequences Pavirv00009344m|PACid:23761127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]