SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00010081m|PACid:23779507 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00010081m|PACid:23779507
Domain Number 1 Region: 487-567
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000538
Family Myb/SANT domain 0.000036
Further Details:      
 
Domain Number 2 Region: 299-367
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000345
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00010081m|PACid:23779507
Sequence length 578
Sequence
MVAQKRLCHGSRGRQIPVISYVQNSVQKDCCSGCVASSGGVSALARQANDSWEENSSTRN
EAESVLESITVKSDMLVRDSSVRCTRPCEISHGLDIIREPGAFGVRHPGSSCSAEVVQAH
QAEPIRRQTDGHAAALDSLFDSVDLDGRPPALVSSDSSSRVLLCRHDKEHKALCKVEVHH
TADRDNDENSSGCTHPSTTGNEGYKPHYLGNHRIRKLLASKVRKAACKTCGGMSNKGSKL
SFYGKKIPGTRQKVRRTNFKRTKLTRGATKGMLTGACGTSFTTKGQNKLCGFEDYQVNLK
INSFNIPELFVEIPETATIGSLKRTVMDVVTSIMEDGLRVGVLLQGKSIQDDNKTLHQAG
ICHGEKLNNIDFTLECDRQQDSPSGVIIQEEMDFASADIVEPLARMKYEEPFPETKGGCG
NQQPMKAYLNGSLAGCVHHPVEMASQDTSASLQSVIRVAASDLNALATVPICKARRSEIG
QRRARMPFSVGEVEALVEAVEQLGTGRWKDIKMHGFDGADHRTYVDLKDKWKTLVHTASI
SPQQRRGEPVPQELLDRVLSAQAYWSQQQEASWKGSCS
Download sequence
Identical sequences Pavirv00010081m|PACid:23779507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]