SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00012534m|PACid:23804206 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00012534m|PACid:23804206
Domain Number 1 Region: 26-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000177
Family Ubiquitin-related 0.0033
Further Details:      
 
Domain Number 2 Region: 103-182
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000322
Family Ubiquitin-related 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00012534m|PACid:23804206
Sequence length 421
Sequence
MSSAGAATAARAARDELGLLPLRPAPDGSITIYLTAPGLAVMPMRVMATDSIASVKLRVQ
TSRGVVVRKQKLVFRGRELARNDSPVRDYGVADGNVLHLVIRVPDLRHITVETLHGSKFR
FRVEPGRTVGYVKQQIAKDSRLDPAAHPDEQMLVLEGEELDDRHLIHDVCRVDGAVIHLL
VQRSAAKASRDFEVSIVARDAAQHQPLPRDFGIEPVVGNPKAQLPSALRDLVSAVRAGMA
NGNAPVMSSEGTGGAYFMQDASGHQHVAVFKPVDEEPMAANNPRGLPVSSTGEGLKKGTR
VGEWGLREVAAYILDHPPGGRRSFTGHGAAGFAGVPPTALVRCMHRGFRQPEGSAQPPAF
KFGSMQAFVKNCGSCEDMGPRAFPVQEVHKICVLDIRLANADRHAGNILVCRDDQGRGMS
L
Download sequence
Identical sequences Pavirv00012534m|PACid:23804206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]