SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00015631m|PACid:23802593 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00015631m|PACid:23802593
Domain Number 1 Region: 125-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000668
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00015631m|PACid:23802593
Sequence length 251
Sequence
TDGLTIIPEYDWNLFSEEWSATPEKGISAEIAFSKSSQDKLPEASEATPIMDGDLDQSLD
GANDDVGDREPYVRTDPEVCEECIGERENCALVEKLNYQNEDIHVYLVRGKEAPKSIKEA
SKSVAVSDRRTSKRSRRTSSGNSISLKVSGSTSVYQLKLMIWESLGIVKENQKLHKGSVE
IEDDLATLADKSIFPGDVLWVRDSEIYENRDIADEISEQKADMPQAEEGFRGTLLTSSVS
AQLCQDVAFSE
Download sequence
Identical sequences Pavirv00015631m|PACid:23802593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]