SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00018066m|PACid:23805144 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00018066m|PACid:23805144
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.37e-23
Family Ubiquitin-related 0.0019
Further Details:      
 
Domain Number 2 Region: 489-531
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000438
Family UBA domain 0.0055
Further Details:      
 
Weak hits

Sequence:  Pavirv00018066m|PACid:23805144
Domain Number - Region: 182-233
Classification Level Classification E-value
Superfamily ARM repeat 0.0834
Family Mo25 protein 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00018066m|PACid:23805144
Sequence length 534
Sequence
MGGGDADADAGGEHAAAQATLHIRCTNGSKFAVRADLGATVGAFKAIVAESCDVPAPQQR
LIYKGRILKDEQTLASYGVETDHTIHMVRGAAPPLASTAPAANQETSTTAPASSPAAGLG
GLLPGLGATGAANSGGLGLFASGLPELDQMQQQLADNPNLMREIMNMPLMQNLMNNPDLI
RNIIMNNPQMRELIDRNPDLAHVLNDPSILRQTVEAARNPELMREMMRNTDRAMSNIESS
PEGFNMLRRMYETVQEPFLNATTMGGEGDRNANPFAALLGNQGTNQTRDPAANAPTTASD
PAAGSPAPNTNPLPNPWGSNAGSAQGAARPPPASNTNTRTATAGGLGGLGSADLGSVLGG
GADASFLSQVLQNPTMMQMMQNIMSNPQSMNQLFNMNPNVRNMMESNTQLREMFQNPEFL
RQLTSPETLQQLISFQQSLMSQLGQQAGQERTQSGTGAGNVNLNTLMNMFSGLGAGGGLG
VPNAPNVPPEELYATQLTQLQEMGFFDTQENLRALIATAGNVHAAVERLLGNLG
Download sequence
Identical sequences Pavirv00018066m|PACid:23805144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]