SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00018624m|PACid:23816660 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00018624m|PACid:23816660
Domain Number 1 Region: 103-271
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.06e-35
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000463
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-23
Family Ubiquitin-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00018624m|PACid:23816660
Sequence length 272
Sequence
MPTVSVKWQKEVFPGIEIDTSQPPIVFKSQLYTLTGVPPERQKIMVKGGILKDDADWSTL
GVKDGQKLMMIGTADEIVKAPEKGPVFVEDLPEEEQVVALGHSAGLYNLGNTCYMNSTLQ
CLHSVPELKSALLSYSDTGRGNGIDQASHNLTLATRNTFGELDQSVRPVAPLQFLQTLRK
KFPQFAQQHNNVYMQQDAEECWTQLVYTLSQTLTSDASESAALSMKQLFGIDLVSRVHCV
ESGEESTETESVYSLKCHISQDVNHLHEGLKH
Download sequence
Identical sequences Pavirv00018624m|PACid:23816660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]