SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00019808m|PACid:23792887 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00019808m|PACid:23792887
Domain Number 1 Region: 123-208,352-398,429-489,530-536
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.02e-25
Family Calcium ATPase, transmembrane domain M 0.037
Further Details:      
 
Domain Number 2 Region: 206-276,310-348
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.89e-16
Family Calcium ATPase, transduction domain A 0.01
Further Details:      
 
Domain Number 3 Region: 482-521
Classification Level Classification E-value
Superfamily HAD-like 0.00000825
Family Meta-cation ATPase, catalytic domain P 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00019808m|PACid:23792887
Sequence length 637
Sequence
MDDVPARLPDPVPSPILRHSPANSVRRTRSLRSLLADSPSVTFAAANLRSGSKAESMASS
LESFQFQRDGSRSATPAGLGRVSTRRSASERAGSQRDLRDEDARFVYINDAERTNAPPAG
LPDNAVHTTKYSVLTFLPRNLYEQFHRVAYLYFLVLVALNMVPQLGVLTPAVSILPLAFV
VSVSAVKDAYEDWRRHRSDKNENNRTASVLAAGGEFRPKRWEEVRVGEVLRVVANETLPC
DMVLLSTSDPTGVAYVQTINLDGESNLKTRYAKQETMATPPEALTGVIKCERPNRNIYGF
LATVDLDGRQRQAISLGPSNIVLRGCELKNTAWAVGVAVYTGRDTKVMLNSSGAPSKRSR
LETHMNRETLMLAVVLFVLCSVVALLAGIWLGDHGDDLAAIPFFRKRDFSSADDPDATYN
WYGMGAEVAFTFMKSVIQFQVMIPIALYISMELVRVGQAFFMVQDRHMFDEKREAKFQCR
ALNINEDLGQIKYVFSDKTGTLTENRMEFRCASVHGADFSDADGANAGDGHSVTDNDGVV
LRPKTAVRTDPRLVALLRDGAGAKADRARDFFLALATCNTIVPIAAAGAAGERERVLEYQ
GESPDEQALVYAAAAYGYTLVERTSGHIIVDVFGARQ
Download sequence
Identical sequences Pavirv00019808m|PACid:23792887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]