SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00021722m|PACid:23766392 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00021722m|PACid:23766392
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.17e-33
Family Ubiquitin-related 0.0000299
Further Details:      
 
Domain Number 2 Region: 105-156
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.83e-16
Family Ribosomal protein S27a 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00021722m|PACid:23766392
Sequence length 164
Sequence
MQIFVKTLTGKTITLEVESSDTVANVKAKVQDKEGVPPDQQRLIFAGKQLEDGRTLADYS
VQKESTLHLVLRLRGGGGGKKRKKKTFTAPKKAGHEHRSVGLAGVLGRYRVDEAAGKVER
LRRECPNLECGPGTFMAAHADRHACGRCGLTYAVESRSKAELAD
Download sequence
Identical sequences Pavirv00021722m|PACid:23766392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]