SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00022528m|PACid:23776120 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00022528m|PACid:23776120
Domain Number 1 Region: 464-580
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.88e-25
Family UBX domain 0.0026
Further Details:      
 
Domain Number 2 Region: 2-44
Classification Level Classification E-value
Superfamily UBA-like 0.000000663
Family TAP-C domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00022528m|PACid:23776120
Sequence length 584
Sequence
MARPPQEAIDTFVSITGADEAAAVRVLEEHENDLNGAVNAYFNEGDRSTTRINQNPVPAS
DDDMELDEPLDPMFNRPLFPRTLGNPFAFLDPGLADITAADIFRRGPQVTHPREVRQIPI
EVKDTNTQTGSSGQGPVIEDVTGRESFYGPEVHGTVIVDEDDEDLPSTPSAHDPNVPSST
SRPNHSMPSAPPLVDVSDYNNDIEEQMIRAAIEASKREVEGMTNTLNNGESETASRGRGD
DELARAVSLSLETAERERALRQEGTHVVDHSPDLSDKEDTEMIERQGLTGKVGTSRETVD
EENFQEDIGDDDEQPLVRHRYRRGQNRTTDPMESVQMANSPSSSPHPHSVQNDHQHNGSF
EEWGGISSEEHDEAVMLEAAMFGGIPERAPYPFSFPTRGRSTHYPGVARPPSPTLTAQRL
LREQQDDEYLAALQADREKELKAVQEAELRRAEEAAAREAALECQKKEEEEKLKKQREEE
ELESELTAKQASLPKEPLQNDEGAVTVVVRMPDGSRRGRRFLKSDKLQYLYDFIDISRTF
KPGTYRLVRSYPRRVFTDGESQMSLSDLGLTSKHEALFLEKISG
Download sequence
Identical sequences Pavirv00022528m|PACid:23776120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]