SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00023435m|PACid:23790054 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00023435m|PACid:23790054
Domain Number 1 Region: 111-208
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000147
Family UBX domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00023435m|PACid:23790054
Sequence length 282
Sequence
MEAEYPHLQAGPSSSTTLLWPCPTRRRKRGEDGDDDLSPAPVGMDPDADAQRAADKLKAV
SEELGHQIRVFSREKFALQPNKLPSADHEEDDDFYELQPADYFNLVSNMIAEQSKMLKTR
KMREAELAAQRAKITKAVMRVRFPDGYVLEADFLPSERIHSLVDLLMKVLARPDLPFYLY
TVPPKKRILDTSQDFYTAGFVPGANIHFSYDLPEGSHTDDLKAGPFLREEIQSLDGLSLL
LKPASEPDDSRMNSSALQSSVSQPNPVPTTNKKPGKPKWLKR
Download sequence
Identical sequences Pavirv00023435m|PACid:23790054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]