SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00023442m|PACid:23798937 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00023442m|PACid:23798937
Domain Number 1 Region: 315-413
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-16
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 156-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000163
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00023442m|PACid:23798937
Sequence length 424
Sequence
MASSVGGAAAMAKHPRVLLPFTCDSLVRALVSLACVATARTRDRLILLFLFSASPTSLPR
KSAPGRPSSSAPPPARSSSGALRSGGTATSRSWGADGRSSRVRAASTPGGSWSSGTAAGA
CSPSRCSMLAPASGSLSLNHLQQPPATTSGQGTRKLQFIRVLPKDFMKKMLIPAKFMQHY
ILNEHLNNRTAIIFGPLGKVSHIEIEMNQSDVFFSGGWSQFLVLHDITESNALLLRYEGN
MVFTVKVFEPDGCQRESKTKDIRMQQDIEEQQEAPSISIQKHYKNDLSSNNGEKKPKGPV
TCLTKAPLWTKSVFEVGPPSWIKKQINANTLRELALQTAFCDAIGLQEPCIITLKTSMSS
TKSWQVHALPRRRSYRLRLGWSRFCKENDLKLGDICTFDIVETTLWLVVVTRCKEKMNQL
YYVS
Download sequence
Identical sequences Pavirv00023442m|PACid:23798937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]