SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00025536m|PACid:23824360 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00025536m|PACid:23824360
Domain Number 1 Region: 255-305
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0000000000000017
Family XPC-binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 308-368
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000214
Family UBA domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000182
Family Ubiquitin-related 0.0015
Further Details:      
 
Domain Number 4 Region: 140-191
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000557
Family UBA domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00025536m|PACid:23824360
Sequence length 373
Sequence
VAGVKRIIETTQGQSVYPADNQLLIYQGKILKDDTTLESNKVAENSFLVIMLSKAKASSS
GPSTATPAKAPATPAQPATPAAPAASVARSTPPQAPVAAAVTAPPTAQPSPAPAATAPAA
TVAASSDADVYGQAASNLVSGSNLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAID
YLYSGIPENVEAPPVARAPASGQQTNPQSPLTQAAAAPPLQPSPASAGPNANPLNLFPQG
VPSGGANPAAGAGAALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESP
EGGAGGNILGQLAAAMPQAVTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAANY
LLDHGHEFDEPPQ
Download sequence
Identical sequences Pavirv00025536m|PACid:23824360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]