SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00025588m|PACid:23822229 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00025588m|PACid:23822229
Domain Number 1 Region: 357-459
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-20
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 160-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-19
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 3 Region: 1-47
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000108
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00025588m|PACid:23822229
Sequence length 463
Sequence
MVLQRGWEAFVDANHIKENNFMLFRRIEKSRFEVLILESDGCEKVFPCVGVRNTPCIQER
RLDSVDISSSYSHDTTESSGSQRFARCQRSSCSHRGRTANMTATSSSFEESGEDASSENT
SFESDSLEIAPKADYVLSSRRYLSEAQRKKVIALIQEIKPEITVFVSIMRKCNVQSSGPY
LVISKEYALAHFPHETTYLTLQRPSKSKKWHPRFYIRNDRRVYMLRGQWLDFVRDNHVQE
GDICLLLPAKTGRKFTLTVYLLRATETHSSDGSGTGLQRFGPCHGKSIKELASPVHIKEE
STDGEHVSLESSMKEISDGSLNSNDSGGPCDPPYIVPGKSCLSRSQKKIVEAKVRSIQSE
VPIYIVIMKSSSVVVSKQMLEFGAHYAAAYLPAREQTMVLQCNGKTWNTDMVIRNGSRLF
LRGGWPKFVCDNGLRVGDICLFEQKKNESKLTMEVHVISREEF
Download sequence
Identical sequences Pavirv00025588m|PACid:23822229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]