SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00027426m|PACid:23766929 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00027426m|PACid:23766929
Domain Number 1 Region: 164-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-40
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 734-817
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000054
Family PB1 domain 0.028
Further Details:      
 
Weak hits

Sequence:  Pavirv00027426m|PACid:23766929
Domain Number - Region: 33-211
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00027426m|PACid:23766929
Sequence length 852
Sequence
TFLPLRLLPPLPLPLSACLHPLPPSLLLGFPPPPPPPPDPRQMPPAAMAPPPPPQAPSNS
GDPLYPELWRACAGPLVTVPRPGDLVFYFPQGHIEQVEASMNQVAGNQMRIYDLPSKLLC
RVLNVELKAETETDEVYAQIMLMPEPEQNEVAAEKSSSGAAATPRPAVRSFCKTLTASDT
STHGGFSVLRRHADECLPPLDMTQSPPTQELVAKDLHGMEWRFRHIFRGQPRRHLLQSGW
SVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHA
INTKSMFTVYYKPRTSPSEFIIPYDQYMESLKNNYSIGMRFRMRFEGEEAPEQRFTGTIV
GCENLDPLWPDSSWRYLKVRWDEPSTIPRPDRVSPWKIEPASSPPVNPLPLSSRVKRPRQ
APPPSPESSVLTKEGASKIDISSAQTQQHQNSVLQGQEQMTLRNNMTESTDSDATVQKPM
MWSPSPNGKTHTSFQQRPSMDNWMPMGRRETDFKDTRSAFKDARTSSQSFGDTQGFFMPT
FDENHHRLSFNNQFQDQGSAHRFSDPYFYMPQQPSLTVDSSTRMQSASNELRFWSEQNTV
YGNSNDQQKGFTFAQNPSSWLNQPFPQVEQPRVVRPHATVAPFDLEKTREGSGFKIFGFK
VDAASASPIQLTSPMSTMREHVVQTQPPASVNELQPVQTECLPEGSVSTAGTATENEKSI
QQAPQSSKDIQSKSQGASTRSCTKVHKQGVALGRSVDLSKFGDYDELKAELDKMFEFEGE
LVSANKNWQIVYTDNEGDMMLVGDDPWEEFCSIVRKIYIYTKEEVQKMNSKSSAPRKEEP
LASGEVCAATNE
Download sequence
Identical sequences Pavirv00027426m|PACid:23766929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]