SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00030007m|PACid:23776776 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00030007m|PACid:23776776
Domain Number 1 Region: 116-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-48
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 679-760
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000932
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00030007m|PACid:23776776
Sequence length 784
Sequence
MSSSSAASIGQTQPPPPEEEKKCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAAS
TNKEVDGHIPNYPNLPPQLICQLHDVTMHADVESDEVYAQMTLQPLNPQEQNDAYLPAEM
GIMSKQPTNYFCKTLTASDTSTHGGFSVPRRAAERVFPPLDFTQQPPAQELIARDIHDVE
WKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRHASRPQTVMP
SSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYIKAVFHTRISVGM
RFRMLFETEESSVRRYMGTITEVSDADPVRWPSSYWRSVKVGWDESTAGERPPRVSLWEI
EPLTTFPMYPSLFPLRVKHPWYSGVAALHGSWGQQRLHPSLLSNDHDQYQAVVAAAAASQ
SGGYLKQQFLHLQQPMQSPQEQCNLNPLLQQQIMQQASQQQLVSPDSQNMQSVLSPSSIQ
QQLHQLQQMQHAHNDQKQKIQPDQPYQVPSSAVLPSPTSLPSHLREKFGFSDPNVNSSSY
ISSSIHENMLESNFLQGSSKCVDLSRFNQPLVSEQQQQQAWKQKFMGSQSMSFGGSGSLN
SPTSKDGSVDNKVGHDGQNQSLFSPQVDNSSLLYNMVPNLTSNVADNNISAIPSGSTYLQ
NPTYGCLDDSSGLLQNTGENDPTTRTFVKVYKSGSVGRSLDITRFSNYAELREELGQMFG
IKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGKQGNDP
RYLS
Download sequence
Identical sequences Pavirv00030007m|PACid:23776776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]