SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00030795m|PACid:23814695 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00030795m|PACid:23814695
Domain Number 1 Region: 120-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-40
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 976-1051
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000285
Family PB1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00030795m|PACid:23814695
Sequence length 1090
Sequence
MAAPGTSSGGAGGEGGGGGTKVNQELWYACAGPLVALPPAGSLVVYFPQGHSEQVASSMQ
KDADAKIPSYPNLPSKLICILSSVTMHADPDTDEVYARMTLQPVNNCDKETLLASELALK
QTRPLTEFFCKTLTASDTSTHGGFSVPRRAAERIFPHLDFSMQPPAQELQARDLHDSIWT
FRHIYRGQPKRHLLTTGWSLFVSGKRLLAGDSVLFIRDARQQLLLGIRRANRQPVNLSSS
VLSSDSMHIGILASAAHAAASNSQFTVFYNPRASPSEFVIPFAKYQKAVYSNQLSLGMRF
RMMFETEESGTRRYMGTITGVSDMDPVRWKNSQWRNIQVAWDEAAPSERRTRVSLWEIEP
VIAPFFIYPSPLFTAKRPRQPGITDDETSDMENLFKRTMPWFGEEIYKKDLNTQNNLVPG
LSLVQWMQQNPSLTSTVGQPELLNSLAGKPVQTLAAADLSRQISFQPQFLQQNNIQFNTS
LLPPQNQQTEQLAKVIATPNQSGSVMVSQKVVQDCNPEQKQHAITQPVQGNQPMKSVAQP
QFVVQNQLLQPQVILQAQPQQSQVIVQAQIQQQPLVQNHTILQSGTQQIHLLQQQQPHLQ
RQPLQVQQSVQEQQQIKIQPIQVPNDMNMITQLSDHQMKIQLLKALQPQQPLVMEQQKMI
LDLQHQTVNSNSQSSAQQCAQVGGMHNSNTIQYLTQQKTQPHQPIQDFPGNAASVANPEI
ATSVGARFLHVPGGVQSLKTEDVPSSSTSPPTNNNPVLSQSVPCSSKDKSLLAVAKTPQS
SAIVSPTLEQGMKPYESIQQMVMIPKMAEQKPGTRQDYVNNTQMDYLDTSSSANSVCLSQ
ADGSLHQNFPSSSFNQHQLLRETVPDSEFEVTDPGNNFLFGANIDGHLESLNADALLANN
FETEKYMDQMPGHGISDYISSKDSQQELSSSMISHSFGVAEIAFNSIDSSINDTPFLNRN
SRPPRPAHQRIRTYTKVHKRGAVGRSIDINQYSGYDELKHDVARMFGIEGQLSDQNRGGW
KLVYEDHEKDVLLVGDDPWEDFVNCIRCIRILSPQEEMQMRLASDFGDSFLPNQACSSSD
GVHPWRVSGD
Download sequence
Identical sequences Pavirv00030795m|PACid:23814695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]