SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00035676m|PACid:23774406 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00035676m|PACid:23774406
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-29
Family Ubiquitin-related 0.0000986
Further Details:      
 
Domain Number 2 Region: 86-137
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.000000000000751
Family Ribosomal protein L40e 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00035676m|PACid:23774406
Sequence length 140
Sequence
MQIFVKTLTGKTATLEVKSSHTVANIKAMIQDKEGIPLDRHWLIFAGKQLEDERTLADYS
VQKESTLHLVLRLSGGGKGGSYRRNVEPNLLQLALKYRRQRNMICRECYARNPIRAYNCR
KKKCGHFNELRLKKKLAYKD
Download sequence
Identical sequences Pavirv00035676m|PACid:23774406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]