SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00037435m|PACid:23761715 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00037435m|PACid:23761715
Domain Number 1 Region: 317-413
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 2 Region: 146-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000149
Family B3 DNA binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00037435m|PACid:23761715
Sequence length 416
Sequence
MASSAGRDGAQIKHPRVLLPFTCDSLTSSPRGSALRRPSSSARPAARPSTGASRSGGTAT
ARSWGAGGRSSRTRAASRPGGCWSSATAAMASSPSRRSMPTAASSGSSSALPLRVQMIGI
KKMQQDSSNSQLWCFGATASSKGASRKPQFIRVHSRDFMEKLLIPSEFVQQHLPNEKLNN
RQAIIFGPLGEVSHIELEKNSSDDVFFSGACWLKFRLFYNITEADALQLTYEGNMVFTVK
VFDHDGYQRESNHKETRAQLATSSDIGEQERQEAPSVSIQKHCKIKVPGSDGEKKPKGIA
TPLNEEPSWMKPVYEIGRPSSVKKQINANTLKELYLPPVFCKAIGISKPCTVTLKTSMSS
TRTWQARVAPYQGTSHHVSGQGWTQFCRENRIKVGDVCTINFVETTMWHVIINSRE
Download sequence
Identical sequences Pavirv00037435m|PACid:23761715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]