SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00043091m|PACid:23807574 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00043091m|PACid:23807574
Domain Number 1 Region: 18-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-23
Family Ubiquitin-related 0.0013
Further Details:      
 
Domain Number 2 Region: 524-566
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000171
Family UBA domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00043091m|PACid:23807574
Sequence length 570
Sequence
MASGGEGAGSGESPPAAAGEASAAAGATLHIRCANGSKFTVQADLAATVGAFKEVVAGSC
DVPAPQQRLIYKGRILKDEQTLESYGVETDHTIHLVRGVASPAASGAPAAASPLASSTPS
SGPAGGLGGLFPGVGAPRSGRPSGLFGAGFPELEQVEQHLSQNPNLMREIMNMPAMQNLM
NNPDLIRNMIMSNPQLREIMDRNPDLAHVLNDPSVLRQTLEAARNPEIMREMMRNTDRAM
SNIESSPEGFNMLRRMYETVQEPFLNATTMGGEGNTASNPFAALLGNQGSNQPGQPATNA
PIPGSESTTGTPAPNTNPLPNPWSTNAGGAQGAARSGPTSNARTGATGGLGGLGSPDLSS
LLGGLAGSQRSGAAGGLGGLGSADLGIMLGGSPDASFLNQMLQNPAMMQMMQSIMSDPQT
MNQLLNFNPNARNLMESNTQLREMFQNPEFLRQLTSPETLQQLLSFQQSLLGQLGQQPPS
QDGNSLGSATGMQGNPSLDTLMSMLSGLGSGGGLGVPNNSNVPPEELYATQLTQLREMGF
IDNAENIQALVATAGNVHAAVERLLGNLGQ
Download sequence
Identical sequences Pavirv00043091m|PACid:23807574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]