SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00043638m|PACid:23799686 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00043638m|PACid:23799686
Domain Number 1 Region: 6-534
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-89
Family Acetyl-CoA synthetase-like 0.0000231
Further Details:      
 
Domain Number 2 Region: 762-955
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.62e-23
Family Quinoprotein alcohol dehydrogenase-like 0.0057
Further Details:      
 
Domain Number 3 Region: 549-613
Classification Level Classification E-value
Superfamily ACP-like 0.000000535
Family Peptidyl carrier domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00043638m|PACid:23799686
Sequence length 957
Sequence
MAEAAELCCISHAFDRAARRDPGRLAVIHAAASGGDGKERRFTRGDLLAAVASLSRRIAA
ALGGPSTDPRERSGSRGGAAVPRVVGVHALPSVEYVATVLAVLRCGEAFLPLDPAWPEER
VSSAISESNAALLVSSVGSRGARSVFESCTCPVLHLGTDIRQWSWDENGGEYLAWPCEHE
RPRKFCYAMFTSGSTGKPKGVCGTEKDDVLLFKASISFVDHLQEFLSAVLTCTTLVIPPP
REWRANPASLANLIKVYRISRMTSVPSLMEIILPDLAKILSGGCNPLKILIFSGELLSIL
LWKRVYEVLPETTIINLYGTTEVSGDCTFFDCKDLPTILEREELSSVPIGFPISNCEVSL
VTEDGLADEGEISVSGACLFSGYLADPMTSICPGNDEILAHYKTGDFARRLKTGQLIFLG
RKDRTFKTYGQRFSLEEVESILREHPDVNDAAVTFQGNGSLDFKAYLVLKSNNEFLKYTQ
HCSRLNSSQDIMAPVRSWLITKLPLAMVPRLFIPVKSLPLTLSGKIDYAKLCSLECALEP
CEIESESSPDDAHMQVIKRAFSDALHVDEVSEYDDFFALGGNSISAAHVAHKLKIDMRLL
YIYTTPSKLLHALFVESSHVVSPTHEFHDKKRLKVSTSISGSFDPVSANLDNNFRGKGNI
NEEGTHDQFVGNNVNKTVGQLNKNMTCDRHRAKDENLCSDTCSNDGIFSGTPSSPWILNF
YLQKKWSFGCCNKFMHGSEGLLQVEDTCTSMSYNKRGYLMKLWDVPLDSCVDASPLLVVN
NGVMSIFIGSHSQLFLCIDGCSGSVRWSIKLEGRIECSATVTGDFSEVVVGCYNGKIYFI
DMSTGKLSWTYQTDGEVKMQPVVDRMRNIIWCGSYDHYLYALNYKDHCCTYKISCGGSIY
GSPAIDMAQNIIYVASTSGLVTAVSFEEPSFKMVWQYEAGAPIFGSLALDHQSGKGI
Download sequence
Identical sequences Pavirv00043638m|PACid:23799686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]