SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00043770m|PACid:23771209 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00043770m|PACid:23771209
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.19e-17
Family Ubiquitin-related 0.00054
Further Details:      
 
Domain Number 2 Region: 47-91
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0000000000000108
Family Ribosomal protein L40e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00043770m|PACid:23771209
Sequence length 92
Sequence
IPPEQQRLIFAGKQLEDERTLADYNIQKESTLHLVLRLRGGGKGGTYPIIDLNLLQLALK
YRQHKMICRKCYARNSSRAENCRKKKCGHTNE
Download sequence
Identical sequences Pavirv00043770m|PACid:23771209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]