SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00046017m|PACid:23774209 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00046017m|PACid:23774209
Domain Number 1 Region: 125-247
Classification Level Classification E-value
Superfamily BAG domain 2.49e-22
Family BAG domain 0.0029
Further Details:      
 
Domain Number 2 Region: 60-144
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-16
Family Ubiquitin-related 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00046017m|PACid:23774209
Sequence length 325
Sequence
MLGAAPKARKGAPAKLGSVKGAPPAVAVAPAGNKVPAEEVWEVRPGGMLVQKRGGGVSDD
EPSPNVKPVPTIRVKVKHAGVTHEIYISSEASFGELKKLVATKTGLHPDDQKVLYKDKER
DSKAFLDMAGVKDRSKLVVVEDPEAKARRLIEERRNGHLEKAAKAVAAVTAEVNKLAPKV
AALDASVRKGEKVAENDVVQVTELLMNELLKLDAVVADGDVKAQRRMQVKRVQKYVETLD
AVAAKNAAIIRKSGEKAAAPKQQQMPAQQQPRQQQQAPAAGQTRWEMFDLLSSLPSTSSA
SSTTTVSSTASSGAPPTNRLDWMLF
Download sequence
Identical sequences Pavirv00046017m|PACid:23774209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]