SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00046237m|PACid:23816111 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00046237m|PACid:23816111
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000875
Family Ubiquitin-related 0.0014
Further Details:      
 
Domain Number 2 Region: 133-186
Classification Level Classification E-value
Superfamily UBA-like 0.000000000313
Family UBA domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00046237m|PACid:23816111
Sequence length 188
Sequence
VAGVKRIIETNQGQSVYPADSQLLIYQGKILKDDTTLESNKVAENSFLVIMLSKAKASSS
GPSTTTPAKAPATPAQPATPAAPAASVARSTPPQAPAATAVTAPPSAQPSPAPAPAATTA
PAATVAASDADVYGQAASNLVSGNTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERA
IDYLYSVS
Download sequence
Identical sequences Pavirv00046237m|PACid:23816111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]