SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00049706m|PACid:23767671 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00049706m|PACid:23767671
Domain Number 1 Region: 37-157
Classification Level Classification E-value
Superfamily BAG domain 9.61e-19
Family BAG domain 0.0042
Further Details:      
 
Domain Number 2 Region: 6-52
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000207
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00049706m|PACid:23767671
Sequence length 238
Sequence
MALPAGELKKLLSEKTGLHPDDQKVVYKDKERDSKAFLDMAGVKDRSKMLMLEDPAAKAK
RLLEERRTSKAERAAKAIARVALDLDKLATKVSALETIVSKGGQVVDADVVVLTEALMNE
LVKLDSIAADGEVKALRRAQEKRVQKHVETLDAIRAKQSKASGKARPPRQPPAAQQQRRQ
FQPPAPTTATAPAPQTQTASWETFDLLSSVPSTSAAPVTTMAPATTTTPSPRFEWELF
Download sequence
Identical sequences Pavirv00049706m|PACid:23767671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]