SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00055018m|PACid:23777909 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00055018m|PACid:23777909
Domain Number 1 Region: 171-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-18
Family B3 DNA binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 24-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-17
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00055018m|PACid:23777909
Sequence length 504
Sequence
SSQDMGSSCRRCKLRAENAYKNLDDHQKYFLMPMKADFQQAMTIPGELVERFRCEIPAQI
ALRTRNGNCSTVEVAKYPDKIVISAGWAAFCDNYDLHMHGSVLFRYGENSQFYVIIFDQF
GCEEVLSVLEDYAHLRPHDPERCIDSIEAVKCCESCKKLDEHKYYNLGNEEKYFLVFMKD
DFQHEMTVPVGFVKRFKGEFPGEIKLETRNGESYCVGVVKQPDKVSFSSGWGVFVKTYDL
HTDDSLVFKYNGNSWFNVVILSRFGYEKATSVVVNDESVPLHVQRSSRDVMESVNPETET
MQMRSPPREVHTSIQKDSSTDLDVQRTCRDYFESMNLTHEHEVAETMQMRSLPWERQTSL
QTDNITLGNKTMKHLDVHRTRRDDIDSMNPANDHPETLSVQSTPRERRAFLQVDSTIQGN
KTNPIFPATCLNSSGNYLLADNNGLQLRDQHPYVISQKSRLNKNQNKKISERLRCMNSGA
PIFVAVICKTNIHGRFDPVRILSV
Download sequence
Identical sequences Pavirv00055018m|PACid:23777909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]