SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00057734m|PACid:23785511 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00057734m|PACid:23785511
Domain Number 1 Region: 273-543
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000349
Family Tropomyosin 0.00067
Further Details:      
 
Domain Number 2 Region: 706-938
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000144
Family Tropomyosin 0.00062
Further Details:      
 
Domain Number 3 Region: 140-342
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000015
Family Tropomyosin 0.002
Further Details:      
 
Weak hits

Sequence:  Pavirv00057734m|PACid:23785511
Domain Number - Region: 587-687
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000196
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number - Region: 969-1168
Classification Level Classification E-value
Superfamily Tropomyosin 0.000262
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number - Region: 5-155
Classification Level Classification E-value
Superfamily Tropomyosin 0.0556
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00057734m|PACid:23785511
Sequence length 1685
Sequence
SKARKRRIQEIEAELDSSADKLCKLEELKDERSLHAAQEAKRASELDKMLEQAQLNMEEM
EKQISSLQEEIKEHQDKATDHQQIEESLRSTISELKVVQEALELSKSQVADLEQKLASQD
ADISKLTEELNLHCSSEESLKEKTIKLENELTTAHEELQAKLLSLQELETKLDEQAKDRQ
TSEAALEKQNEQIVILQTQLDKLKDENNTIQGSLVDLNSKLSEKDSMLHQAEDKLAKAQL
ALAETLSQKEELELNLNSLSEQHGESKLFGENANQKILELEAQIQAMHAAEEVLKSQLKE
ADASVEAAEKNGSDLEKKLSEIENKLVASSEEIELMKERIQQEVAVSAEKGTQLEEAVAS
VEGYKEKINELQSSLDSSLSKNQLLEQQVKELTDKCSEHQEQAHSVQQRSLELEDLLHAS
KTDAEGAYSRTQELEQELNRTYEKLNGVDTELEQYRSKVSQLSDDLEAYQTKAASLEAVV
EEASKKEKELMESLSQITEEKKKIEELTAEYEAKLQANLKEKQSFEESLQSQELKALDLQ
QELMKLGEEKEHHENTIADLNLQLSTKNDMYSQLESQINEAGDDHSKTRSLLSEAQLHKE
ELEINLKSLNDLHTASKTAAESAMERVSELETQIQELTASEQNLKLQLSELESKLASAEK
TGIDLEQDLKAATIECNNCHVKIDELSGELEAYKEKSTNLETSLAQAKQTEAELSESLAQ
VNEEKEKFEELTKKATIKHLEAEKQAETLQGELESARGKMEEVENELRSLGIRESSVLEK
LKSAEEQLEHKGRALEHATSKKIDSEALYQSLLEDTEMKLQQSADNLAQKDTECQQLSEK
LKLAEEQAASYQSRATAATEEVESMKVELEAFESEISTHESTIEELKIKVSDAESKAEQA
LAELTMLSGTNQALKEELDAKLAMLHEVQEQLNSTRAEKEEVVAKLAEHEKTVEHLTEVH
SRGIELQSAAESRNAEIEAQLREALEAAEKKETEVKNLNEKLVALESEIESLTHVNEALK
QEINAKLVMVDELQEKCSSVNSEKEEIAEKLAVHERKIEHLTEEHSRGLELRSVAESKNA
EIESQLREVLEKVAQKEDEVTDLTEKLALLKAENEKLAIRNKTLKEEVDARMAMFDELQE
RFNSTHAEKEEAAEKLTVHERTISHLTEVHTRSLELHSAAESKNEEIEAQLREALETIAQ
KEGEVKELSKKLDALEIELGYYEEQATEAAATEENHKVKFDEASQKIKILEEQLEEAQSK
VEHFLTEKESLAQANSSLNVELEVHQNKLNELQLALAAAVAEKEGASEEIHSLRKTLDGM
IERKAEIEIQVSSTMEEHDELKSKYQSTLEEKQILNDKYETTKKELEEAVAKLEEKMNVD
KSEKELHLSKLERQITLSEIKYMEEIKTMQVETTEKDEALTAKMQEHANLQHEKDELEQQ
LLEIRKELDGAYHTIANQEEQASVREIKWDAYRKYSEDQLEAEQQRTAELELQVSALKQQ
LQESEIHYKRKEEQVSLREVQWEADKTHSLDELEAQRQYANDLDIQIEALTQKLQSVDAH
YKQKVTEERDKLAEVTTEFNKLTQKVSKSVELEKKVQDLEQKLKVAYSKSEEQANDAVQL
RSREFTMDSSTTSGKQHDRSSAADTTSPNLSQKEVQEPSGIMAFKFILGVALLSVLIGVF
LGKRY
Download sequence
Identical sequences Pavirv00057734m|PACid:23785511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]