SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00058482m|PACid:23781275 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00058482m|PACid:23781275
Domain Number 1 Region: 583-664
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000428
Family Myb/SANT domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 382-473
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000819
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00058482m|PACid:23781275
Sequence length 683
Sequence
MVFQKRSSEMESCGGGQVAEMPRVPKSARGKRSVRKKEAQSPGQMMCAFDLLATVAGKLL
DEGEGSLVNMSAGAPVLAACAKDVRVKQEQCDEAMKHFKHEVTDQDSCNESAILPHTVFS
RSVNHARSEDPKAKSEALDKESSMISCTKAELGCNFGAIADRWSPESVESGAFTGDAAAS
LMQVATAGFHKNAPDMYNLLDPMDVDVKPPPLVSSDSTGEMPLYGDKIHRSISLPRGPKG
VAGYAVDRDDDDDKSSGCTHPSTTTNRDFRLNCTADHSRVRKLLTSKYRKVAPARMHKSD
LSYSDVERKPSFRNKKMHYTRQRTQRSTFKRRKLFDRHAVLASEFGRANGKGNSKATGRD
SHAVSLEANKGTNSMPFQKSCASNDCHVKLRIKSFKVPELLVEIPESATVGSLKKTVLEA
VTAILGGGLRVGVLHHGKKVRDDSKTLMQAGIGQNDMLDSLGFSLEPNCTHNPSQVQAPE
DISFLETIDTTEPLARIAPADSSSKHGEVDVSQELALTPLAMNYQGSDHDSVHSPGGVSS
PDKVSTNSRALVPVAPADPNAGAVVPVNKSKRSPEQGQRRIRRPFSVAEVEALVLAVEKL
GTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLAAQA
YWSQQQAKLQPKTPPLAEARLLT
Download sequence
Identical sequences Pavirv00058482m|PACid:23781275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]