SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00061921m|PACid:23781698 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00061921m|PACid:23781698
Domain Number 1 Region: 115-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-44
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 553-629
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000137
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00061921m|PACid:23781698
Sequence length 661
Sequence
MAAAMDVANPGAAAGTGMSSNALYRELWHACAGPLVTVPRQGERVYYFPQGHMEQLEAST
HQQLDQYLPMFNLPSKILCSVVNVELRAEADSDEVYAQIMLQPEADQSELTSPDPELQEP
EKCTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMSQNPPCQELVAKDLHGTEWHF
RHIFRGQPKRHLLTTGWSVFVSSKRLVAGDAFIFMRGENGELRVGVRRLMRQVNSMPSSV
ISSHSMHLGVLATASHAISTGTLFSVFYKPRTSRSDFIVSVNKYLEAKKQKMSVGMRFKM
RFEGDEAPERRFSGTIIDIRSLPAMSKSLWADSDWRSLKVQWDEPSSILRPDRISPWEVE
PLDAAQPQSPQPPLRKKRARPPASPSMVAELPSGFGLWKSPTDSARTLSFSEPQRARELF
PSIPTSTFSSSSNVNFNAKNEPSMLNSQFYWSARDTRADSCAASTNTVIVEKKQEHNSGG
CRLFGIDICSTEDEVLPVVTAPALGYDQTAASLVELSSDKLSQPSDVNNSDAPGASSEQL
PLESQSRQVRSCTKVIMQGMAVGRAVDLTKLSGYSDLFHKLEEMFDIQGELGSTLKKWRV
IYTDDEDDMMLVGDDPWNEFCDMVKRIYIYTYEEAKKLTSKSKLPGSSDTSKLSDVSSQS
E
Download sequence
Identical sequences Pavirv00061921m|PACid:23781698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]