SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00068843m|PACid:23770118 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00068843m|PACid:23770118
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.33e-35
Family Ubiquitin-related 0.0000315
Further Details:      
 
Domain Number 2 Region: 103-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.83e-16
Family Ribosomal protein S27a 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00068843m|PACid:23770118
Sequence length 162
Sequence
MQIFVKTLTGKTITLEVESSDTVANVKAKVQDKEGIPPDQQRLIFAGKQLEDERTLADYN
IQKESTLHLVLRLRGGGKKRKKKTFTTPKKAAHEHRSVGLTGVLGRYRVDEAAGKVERLR
RECPNPECGPGTFMAAHADRHACGRCGLTYAVESRSAAELAN
Download sequence
Identical sequences Pavirv00068843m|PACid:23770118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]