SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pavirv00069271m|PACid:23768201 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00069271m|PACid:23768201
Domain Number 1 Region: 584-665
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000428
Family Myb/SANT domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 383-474
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000651
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00069271m|PACid:23768201
Sequence length 684
Sequence
MVFQKRSSSEMESCGGGQVAEMPRVPKSARGKRSVRKKEAQSSGQMMCAFDLLATVAGKL
LDEGEGSLGNMSAGAPALAACAKDVRVKQEQCDEAMKHFKHEVTDQDSCNESAIVPHTVF
SRSVNHVRNEDPKAKSEALGKESSMISCTKAELGCNFGAIADRWSPESVESGAFTGDAAA
SLMQVATVGFLKNAPDMYNLLDPMDVDVKPPPLVSSDSTGEMPLYGDKIRRSISLPRGPK
GVAGYAVDRDDDDDKSSGCTHPSTTTNRDFRPNCTADNSRVRKLLTSKYRKVAPARMHKS
DLSYSDVERKPSFRNKKMHYTRQRTQRSTFKRRKLFDRHAVLASEFGRANGKGNSKVTGR
DSHAASLEANKGTNSMPFQKSCASNDCHVKLRIKSFKVPELLVEIPESATVGSLKKTVLE
AVTAILGGGLRVGVLHHGKKVRDDSKTLMQAGIGQNDMLDNLGFSLEPNCTHNPSQVQAP
EDISFLETIDTTEPLARIAPADSSSKHGEVDVSQELALTPLAMNYQGSDHDSVHSPGGVS
SPDKVSTNSRALVPVPPADPNAGAVVPVNRSKRSPEQGQRRIRRPFSVAEVEALVLAVEK
LGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLAAQ
AYWSQQQAKLQPKTPPLAEARLLT
Download sequence
Identical sequences Pavirv00069271m|PACid:23768201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]