SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383787165|ref|YP_005471734.1| from Fervidobacterium pennivorans DSM 9078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383787165|ref|YP_005471734.1|
Domain Number - Region: 10-70
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0455
Family TRAPP components 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383787165|ref|YP_005471734.1|
Sequence length 246
Comment CRISPR-associated protein, Cas6 family [Fervidobacterium pennivorans DSM 9078]
Sequence
MRVYINFTFDKLELPTEYNHILQAFVLNLIDDEEYRKFLHDKGYTFGKRLYKLFSFSRLL
GRFQIDSQTKTIKFFDHVVLIISTADERLIEFVVDRVGRFENLRLGRNFVVPAKIEIFEL
PETDHIVVSTKSPITVYSTVDKDGKKYTLYHSPHDEIFSKLLEENLKRKFHAAFGREFQG
QLRIKNIAPNPKRVVVGYKERKLDAWITVLELEGDYEILKLAYDAGLGSKNSAGFGCIEL
VGRDII
Download sequence
Identical sequences H9UDM2
gi|383787165|ref|YP_005471734.1| WP_014452051.1.64957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]