SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|456062669|ref|YP_007501639.1| from beta proteobacterium CB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|456062669|ref|YP_007501639.1|
Domain Number 1 Region: 423-565
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 120-278
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.93e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00052
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.45e-34
Family Duplicated SiR/NiR-like domains 1 and 3 0.026
Further Details:      
 
Domain Number 4 Region: 255-279,329-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.32e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|456062669|ref|YP_007501639.1|
Sequence length 575
Comment nitrite/sulfite reductase hemoprotein beta subunit [beta proteobacterium CB]
Sequence
MYKYDHIDQTLVDQRVTQFRDQVERRLNGTLAEEEFRPLRLQNGLYHQRHAYMLRVAIPY
GLLSAKQLRTLAFIADKYDRGYGHFTTRQNIQFNWVELEQTPDILAELAKVEMHAIQTSG
NCIRNITSDAFAGVAADEYIDPRPICELLRQWSTLHPEFAHLPRKFKFAINGAKEDRTVL
LCHDVGVELKKNPEINNGELTADIYAGGGMGRTPILGSLIKQGLPWQVLPSYLTALLRVY
NRFGRRDNLYKARIKILVKALGPEEFARQVEGEWAQLHNDTKQSKDNFTQAEWERVAKHF
TKPNYKTLPALSNAQLQSHVESKLDANEKIAFTRWLERNVKPHQVPGYVSVILSLKPHGT
AAPGDATSAQMNAIADLADHYSFGELRVTHEQNLVLADVEQAELLNLWRAAKNYNLVLPN
IGLLTDIIACPGGDFCSLANAKSLPIAKAIQERFDDLDYLHDLGDITLNISGCINSCGHH
HVGNIGVLGVDKDGEEWYQITLGGEQGNDASIGKVIGPSFYANEIPDVMTSLINTYVEQR
TGDEPFIETYRRLGVTPFKEAAYKNNGKHSKEALT
Download sequence
Identical sequences M1SES1
gi|456062669|ref|YP_007501639.1| WP_015420511.1.101204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]