SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|456062685|ref|YP_007501655.1| from beta proteobacterium CB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|456062685|ref|YP_007501655.1|
Domain Number 1 Region: 25-384
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-86
Family L-arabinose binding protein-like 0.0000765
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|456062685|ref|YP_007501655.1|
Sequence length 394
Comment Extracellular ligand-binding receptor [beta proteobacterium CB]
Sequence
MNIRHHIFAVAAAAMLTTGAYAADIKLGVSGPFTGGSASMGVSMRDGVRLAAKEINAAGG
INGNKIVLVERDDEAKNERGVQIAQELINNEKVVATLGYINTGVALASQRFYQDAKIPVM
NNVATGSILTKQFPNAPENYVFRNAAPDNIQAPLIAKEAVEKRGLKRVAILADSTNYGQL
GREDLEKALKGYGVTPVAVEKFNIGDVDMTSQLLKAKNAGADVILTYAIGPELAQIANGM
AKLGWKKPMIGSWTLSMASFIDTAGKNGNGASMPQTYIQTPSTTAKRKAFQAAYLAEFKP
KNNNIASPVSAAQGYDSVYLLAAAIKQANSTEGPKIVAALQDLKTPVDGVVITYNKPFSA
TDHDAIKMKDVVMGVVENGRVEFLNAEDATPKKK
Download sequence
Identical sequences M1RR07
gi|456062685|ref|YP_007501655.1| WP_015420527.1.101204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]