SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000039 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000039
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily PRTase-like 1.99e-30
Family Phosphoribosyltransferases (PRTases) 0.0023
Further Details:      
 
Domain Number 2 Region: 175-279
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.7e-25
Family Decarboxylase 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000039   Gene: ENSLACG00000000033   Transcript: ENSLACT00000000040
Sequence length 290
Comment pep:known_by_projection scaffold:LatCha1:JH137202.1:21:3478:1 gene:ENSLACG00000000033 transcript:ENSLACT00000000040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGLLFQTAKDAGVNYDSICGVPYTALPLATIICSSNEIPMLLRRKEAKDYGTRRLVEGT
ITPGQVCLIIEDVVTSGSSVFETTEVLKKEGLVVKDAIVLIDREQGGKARLEEAGICLHS
VCSLSRLLEILHKRERIDAEMLETVRKFIRENNTWKPARENRLPPAANVCKEMSYAARAE
LPGAHPLAARLFEVMEKKQTNLCLSADVTDSEELLGLADSLGPEICVLKTHVDILSDYSA
GVTEQLKALADHHGFLIFEDRKFADIGNTVKKQYEGNCGNGGSSNFHFRA
Download sequence
Identical sequences H2ZRL8
ENSLACP00000000039 ENSLACP00000000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]