SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001690 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001690
Domain Number 1 Region: 38-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.29e-21
Family Histidine biosynthesis enzymes 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001690   Gene: ENSLACG00000001513   Transcript: ENSLACT00000001703
Sequence length 276
Comment pep:known_by_projection scaffold:LatCha1:JH126914.1:20949:40015:-1 gene:ENSLACG00000001513 transcript:ENSLACT00000001703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLQLFGRLRSAVIGMVHVKALPGSSLNTLLVVTISEEACREAEVYSAAGIDGLIIENM
HDLPYALSVGPEVTAAMAAVCIAVRQVCPSPPLEIQILSAANQQALAVALAAGSFDFIRA
EGFVFSHIADEGLLNVCAGDQLRYRKQIGAEHIQIFTDIKKQHSSHASTSDISLSETAKA
AEFFLSDGVVLTGTATGMQADLEELREVQQNVRIPVIIGSGVTYKNVVNYMEASAMIIGS
HFKKGYWANSVDPERVKKFMEKIHKFQCKSSAVKLQ
Download sequence
Identical sequences H2ZWB9
ENSLACP00000001690 ENSLACP00000001690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]