SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004296 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004296
Domain Number 1 Region: 318-446
Classification Level Classification E-value
Superfamily Plus3-like 2.09e-45
Family Plus3 0.000000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004296   Gene: ENSLACG00000003822   Transcript: ENSLACT00000004334
Sequence length 528
Comment pep:known_by_projection scaffold:LatCha1:JH129842.1:98080:188522:-1 gene:ENSLACG00000003822 transcript:ENSLACT00000004334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKRKGRVVIDSDSEDSGSDENLDQELLSLAKRKRSDSEEKETPAVKPSASSDSETSDS
GDEWTVGGNKTKKKGKSGKGGDKKGTTKKRVNKAASSGTSDGESSAVSSAPEEGEVSDSE
SNSSSSSSDSDSSSEDEEFYDGYDEDLMGDAEDRARLEQMTEKEREQELFNRIEKREVLK
RRFEIKKKLKTAKKKEKREKKKKQEEEQEKKKHSSQIPESQVMSHNKERRSKRDEKLDKK
SQAMEELKAEREKKKNKTAELLAKKQPLTTSEVYSDDEEEEEDDKSSVKSDRSSRSSSSD
EEEEKEEIPPKSQPVTLPEELNRIRLSRHKLERWCHMPFFSKTVTGCFVRIGIGNHNSKP
VYRAAEITGVVETGKVYQLGSTRTNKGLQLRHGSDQRVFRLEFVSNQEFTESEFMKWKEA
MFSAGMQFPTLDEITKKELAIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLK
EKAMAEESGDPDKAKMIQDQLNELEERAEALDRLRTKNISAIRRRVRT
Download sequence
Identical sequences H3A3S5
ENSLACP00000004296 ENSLACP00000004296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]