SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010778 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010778
Domain Number 1 Region: 95-169
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000418
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010778   Gene: ENSLACG00000009490   Transcript: ENSLACT00000010858
Sequence length 225
Comment pep:known_by_projection scaffold:LatCha1:JH127167.1:425278:430489:-1 gene:ENSLACG00000009490 transcript:ENSLACT00000010858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFQNATKENHKALSLEEIRKKIEEYNESVTNCLGMKLNDDGTFTGFIKVHLKLRRPVTVA
SDSRPTSIYDGKGEVNPADIPEERTSFYLPLDAVKQIHVSSINTVSEVIFWLLKKFMVVD
NPKKFALFTEAKKDGRVLIRKLPEAEYPLYLRLLAGPDTEALSFVLKENEMNDVEWDAFS
LPELQNFLIMMEKEEKDKIQQVEKKYAKFRQQMEQALKEAREKPG
Download sequence
Identical sequences H3AMA7
ENSLACP00000010778 ENSLACP00000010778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]