SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013695 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000013695
Domain Number - Region: 20-73
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013695   Gene: ENSLACG00000012053   Transcript: ENSLACT00000013792
Sequence length 224
Comment pep:novel scaffold:LatCha1:JH127340.1:669360:670622:1 gene:ENSLACG00000012053 transcript:ENSLACT00000013792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETISQVTLKDINIFKRKTFKRVATMEQKMHRAESKLTEHGECLDHIEEELEYQSGYSRDL
WDRVQDLENRCRRNNIQVLGVPEGAEGNDSFGHVFLLNLLRKFLPLYEAGVLEIEQSHRT
LGLMLDPDQHPRPIIARFLHFRDRNNILRLAREAGELCWRRGKIMIFPDMSRELAMQRHL
FTPDRWCCMVLGLKYALQYPATLQVTINGWQKKFTDPEEALTEL
Download sequence
Identical sequences H3AVM4
ENSLACP00000013695 ENSLACP00000013695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]