SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014978 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000014978
Domain Number - Region: 3-57
Classification Level Classification E-value
Superfamily Tropomyosin 0.0458
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014978   Gene: ENSLACG00000013182   Transcript: ENSLACT00000015083
Sequence length 219
Comment pep:novel scaffold:LatCha1:JH127188.1:819652:820601:-1 gene:ENSLACG00000013182 transcript:ENSLACT00000015083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIQALQSSVDNLNNKITIAETRILLTEDKNRSRDALIQHLQSRLTVAVDRIEDLENQSRQ
NNLRILGFPEGAERGNPSASLSKVIPKLLDLDPSSPLDIERAYCSLEPHPPPDHRPRAFI
VKLLRYFTRDKILKAAWEKGRTFWQDKRISFCPDLSKDLQQKRQRFSDVHHQLLGHGMFY
PATLKVTYNGVTSAYTSPEEVSTFNVIYLIVPMGPHIRT
Download sequence
Identical sequences H3AZA7
ENSLACP00000014978 ENSLACP00000014978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]